PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf20961g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 241aa    MW: 27472.7 Da    PI: 7.125
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf20961g00008.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.14.4e-3354107357
               ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                               + +YkeClkNhA+++GghavDGCgEfmp+ ge+g+ ++lkCaAC+CHRnFHR+ +
  Niben101Scf20961g00008.1  54 RPKYKECLKNHAVTIGGHAVDGCGEFMPA-GEDGSLDSLKCAACNCHRNFHRKIT 107
                               679*************************9.999*******************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2156108IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015669.7E-3156105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.8E-2956106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.73557106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.4E-30167240IPR009057Homeodomain-like
SuperFamilySSF466891.92E-18168239IPR009057Homeodomain-like
PROSITE profilePS500718.859176240IPR001356Homeobox domain
TIGRFAMsTIGR015653.5E-25178235IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MDFENHQEEE ETELPPRHDD SLDNSNKTHP TKMPSPTPME LEPLAVVHTW HNNRPKYKEC  60
LKNHAVTIGG HAVDGCGEFM PAGEDGSLDS LKCAACNCHR NFHRKITQPP PNAIESLPFV  120
NYHSPYYRSL PPPCGYPQYH VAPQQRPLAL PSTSGGGVYR EDQEDMSNLN NSGGSGSKKR  180
FRTKFSQEQK EKMQELADKL GWRIQREDEE LVQQLCNETG VRRQVFKVWM HNNKNTLGKK  240
P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A9e-241772361675ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009769511.11e-168PREDICTED: zinc-finger homeodomain protein 2-like isoform X2
RefseqXP_016472938.11e-168PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ9SB612e-66ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLK4BPT01e-122K4BPT0_SOLLC; Uncharacterized protein
STRINGSolyc04g014260.1.11e-121(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.14e-63homeobox protein 22